Recombinant Human IL-1 beta/IL-1F2 GMP Protein

Cat. No.: rp168388-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P01584
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <12 pg/mL. The specific activity of recombinant human IL-1 beta is >5.0 x 10^7 IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
100μg
rp168388-GMP-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,319.90
1mg
rp168388-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$7,371.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-1 beta/IL-1F2 GMP Protein
Synonyms
Interleukin 1 beta | catabolin | IL1 beta | IL-1 beta | IL-1 | IL1B | IL-1b | IL1-BETA | IL-1F2 | IL1F2 | interleukin 1, beta | interleukin-1 beta | preinterleukin 1 beta | pro-interleukin-1-beta | IL1beta
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast
Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <12 pg/mL. The specific activity of recombinant human IL-1 beta is >5.0 x 10^7 IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
Endotoxin Concentration
<0.01 EU/μg
Expression System
E. coli
Amino Acids
117-269 aa
Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Protein Tag
No tag
N-terminal Sequence
Ala-Pro-Val-Arg-Ser-Leu-Asn-(Cys)-Thr-Leu & Pro-Val-Arg-Ser-Leu-Asn-(Cys)-Thr-Leu-Arg
Accession #
Predicted molecular weight
17 kDa
SDS-PAGE
17 kDa under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 100-200 μg/mL in PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.