Recombinant Human LAG-3 Protein

Cat. No.: rp176292

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

P18627

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

1. Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC50 of 36.43 ng/mL. 2. Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC50 of 41.53 ng/mL.

Overview

Protein Function：
LAG-3 (Lymphocyte activation gene-3), designated CD223, is a 70 kDa type I transmembrane protein that is a member of the immunoglobulin superfamily (IgSF). LAG-3 shares approximately 20% amino acid sequence homology with CD4, but has similar structure and binds to MHC class II with higher affinity, providing negative regulation of T cell receptor signaling. Human LAG-3 cDNA encodes 525 amino acids (aa) that include a 28 aa signal sequence, a 422 aa extracellular domain (ECD) with four Ig-like domains, a transmembrane region and a highly charged cytoplasmic region. Within the ECD, human LAG-3 shares sequence identity with mouse, rat, porcine, and bovine LAG-3. LAG-3 is expressed on activated CD4+ and CD8+ T cells, NK cells, and plasmacytoid dendritic cells (pDC), but not on resting T cells. LAG-3 on activated CD4+CD25+ Treg cells plays a role in their suppressive activity. LAG-3 limits the expansion of activated T cells and pDC in response to selected stimuli. A soluble 54 kDa form, sLAG-3, can be shed by metalloproteinases ADAM10 and TACE/ADAM17. While monomeric sLAG-3 itself may be inactive, shedding allows for normal T cell activation by removing negative regulation. Binding of a homodimerized sLAG-3/Ig fusion protein to MHC class II molecules induces maturation of immature DC, and secretion of cytokines such as IFN-gamma and TNF-alpha by type 1 cytotoxic CD8+ T cells and NK cells. sLAG-3/Ig has been used as a potential adjuvant to stimulate a cytotoxic anti-cancer immune response. In mice, deletion of LAG-3 and another negative regulator, PD-1, facilitates anti-cancer response but also blocks self-tolerance and increases susceptibility to autoimmune diseases. In humans, antibody-mediated down regulation of LAG-3 and PD-1 allows more effective control of chronic malaria, while in NOD (non obese diabetic) mice, deletion of LAG-3 alone accelerates diabetes. LAG-3 is an immune checkpoint protein that modulates T-cell activation and homeostasis and is a promising target for cancer immunotherapy.

Specifications

Product Name

Recombinant Human LAG-3 Protein

Synonyms

CD223 | CD223 antigen | FDC protein | LAG-3 | LAG3 | Lag3 | LAG3_HUMAN | Lymphocyte activating 3 | Lymphocyte activation gene 3 | Lymphocyte activation gene 3 protein | Protein FDC | lymphocyte-activation gene 3 | Secreted lymphocyte activation gene 3 pro

Grade

ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactivity

1. Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC50 of 36.43 ng/mL. 2. Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC50 of 41.53 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

HEK293

Amino Acids

1-450 aa

Sequence

MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLHHHHHH

Protein Tag

C-His

Accession #

P18627

Predicted molecular weight

47.0 kDa

SDS-PAGE

57.5 kDa, under reducing condition; 52.3 kDa, under non-reducing condition

Molecule Type

Protein

Storage and Shipping

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Binding Activity: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - Binding Activity
Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC₅₀ of 36.43 ng/mL.

ELISA: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - ELISA
Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC₅₀ of 41.53 ng/mL.

SDS-PAGE: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - SDS-PAGE
3 μg/lane of Recombinant Human LAG-3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 57.5 kDa under reducing conditions and 52.3 kDa under non-reducing conditions.