Recombinant Human CXCL9/MIG Protein

Cat. No.: rp170398
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q07325
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp170398-10μg
9
$139.90
50μg
rp170398-50μg
5
$375.90
100μg
rp170398-100μg
5
$599.90
1mg
rp170398-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,675.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CXCL9/MIG Protein
Synonyms
chemokine (C-X-C motif) ligand 9 | CMK | crg-10 | C-X-C motif chemokine 9 | CXCL9 | Gamma-interferon-induced monokine | Humig | MIG | MIGSmall-inducible cytokine B9 | monokine induced by gamma interferon | SCYB9Monokine induced by interferon-gamma
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Chemokine (C-X-C motif) ligand 9 (CXCL9), also known as Monokine induced by gamma interferon (MIG), is a small cytokine belonging to the CXC chemokine family. The function of this chemokine has not been specifically defined; however, it is thought to be i
Bioactivity
Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
22-125 aa
Sequence
GTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Protein Tag
No tag
Accession #
Predicted molecular weight
11.8 kDa
SDS-PAGE
14.3 kDa, under reducing conditions; 15.1 & 28.8 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CXCL9/MIG Protein (rp170398) - Protein Bioactivity
Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL.

Recombinant Human CXCL9/MIG Protein (rp170398) - SDS-PAGE
3 μg/lane of Recombinant Human CXCL9/MIG Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.3 kDa under reducing conditions and 15.1 & 28.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F1011590Certificate of AnalysisMay 22, 2026 rp170398
ZJ24F1011591Certificate of AnalysisMay 22, 2026 rp170398
ZJ24F1011592Certificate of AnalysisMay 22, 2026 rp170398
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.