Browse products and resources organized by application and industry—drug discovery, analytical chemistry, chemical manufacturing, energy, electronics, medical devices, and more. Use these pages to discover recommended chemistries, materials, and lab tools aligned with your workflow.
Applications
Shop by category
Analytical Chemistry
2,761Products and resources for analytical chemistry workflows, from sample preparation to measurement and quality control. Explore reference materials, solvents, and lab tools to support chromatography, spectroscopy, and routine analysis.
Chemical synthesis
207,921Explore products organized around chemical synthesis workflows, from route scouting to scale-up. Discover recommended building blocks, reagents, catalysts, and analytical support to plan, execute, and optimize reactions.
Explore products for biopharmaceutical and biotech workflows, from discovery to process development. Find reagents and raw materials for cell culture, protein work, and bioprocessing—organized to streamline upstream and downstream steps.
Drug Discovery
123,451Tools and reagents for drug discovery—from screening libraries and chemical probes to assay and enabling technologies. Explore collections organized by target, pathway, or modality to accelerate hit finding and validation.
Products organized for diagnostics and molecular testing workflows, including nucleic-acid prep, amplification, and detection. Use this application hub to find reagents and consumables that support assay development and routine testing.
Explore products relevant to medical device development and biomaterials research, from prototyping to testing. Browse materials, reagents, and reference items that support biocompatibility, performance, and QC evaluation.
Application-focused products for medical aesthetics and personal care R&D. Discover ingredients, materials, and analytical support to help formulate, test, and validate new products.
Products for semiconductor and microelectronics R&D and manufacturing support. Explore electronic materials, deposition precursors, and analytical standards to aid device fabrication, process development, and QC.
Materials and reagents for display and optoelectronics development. Browse products used in panels and optical devices, with properties and handling information to support your process.
Products organized for photovoltaic and solar research, from materials development to device testing. Explore materials, catalysts, and analytical tools to support efficiency improvements, stability studies, and scale-up.
Explore products for new energy and energy storage, including batteries, fuel cells, and hydrogen technologies. Find materials and reagents to support electrode/electrolyte research, catalysis, and performance testing.
Application hub for aerospace and aviation research and manufacturing needs. Discover materials, chemicals, and analytical resources relevant to surface treatment, composites, testing, and reliability.
Explore products supporting advanced materials and manufacturing—from novel polymers and composites to process development. Find materials, reagents, and lab tools aligned with fabrication, characterization, and scale-up.
Products and resources for chemical manufacturing and catalysis, covering process chemistry, catalysts, ligands, and analytical support. Explore options to optimize reactions, improve selectivity, and support production workflows.
Application-focused products for environmental monitoring and safety. Browse reagents, standards, and sampling tools to support air/water/soil testing, compliance monitoring, and workplace safety programs.
Browse products curated for academic and government research environments. Explore broad-ranging reagents, materials, and lab essentials with documentation and packaging options suited to institutional workflows.
Products
- NFPS, GlyT1CAS: 405225-21-0 Formula: C24H24FNO3 Molecular Weight: 393.45Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%(HPLC)◐ .Made to order · 8–12 wks Item #: N288067View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 2-[[3-(4-fluorophenyl)-3-(4-phenylphenoxy)propyl]-methylamino]acetic acid
- SMILES
- CN(CCC(C1=CC=C(C=C1)F)OC2=CC=C(C=C2)C3=CC=CC=C3)CC(=O)O
- InChIKey
- FDORQEIHOKEJNX-UHFFFAOYSA-N
- InChI
- 1S/C24H24FNO3/c1-26(17-24(27)28)16-15-23(20-7-11-21(25)12-8-20)29-22-13-9-19(10-14-22)18-5-3-2-4-6-18/h2-14,23H,15-17H2,1H3,(H,27,28)
- Synonyms
- ALX5407 | GTPL4620 | DTXSID30415522 | GTPL4619 | N-[3-(4'-fluorophenyl)-3-(4'-phenylphenoxy)propyl]sarcosine | 2-{[3-...
- GSK2606414CAS: 1337531-36-8 Formula: C24H20F3N5O Molecular Weight: 451.44Solid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US Item #: G125654View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 1-[5-(4-amino-7-methylpyrrolo[2,3-d]pyrimidin-5-yl)-2,3-dihydroindol-1-yl]-2-[3-(trifluoromethyl)phenyl]ethanone
- SMILES
- CN1C=C(C2=C(N=CN=C21)N)C3=CC4=C(C=C3)N(CC4)C(=O)CC5=CC(=CC=C5)C(F)(F)F
- InChIKey
- SIXVRXARNAVBTC-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- AC-29016 | 1-(5-(4-amino-7-methyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)indolin-1-yl)-2-(3-(trifluoromethyl)phenyl)ethanone...
- GSK2636771, PI3-kinase p110-beta subunit inhibitorCAS: 1372540-25-4 Formula: C22H22F3N3O3 Molecular Weight: 433.42Solid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US Item #: G125299View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 2-methyl-1-[[2-methyl-3-(trifluoromethyl)phenyl]methyl]-6-morpholin-4-ylbenzimidazole-4-carboxylic acid
- SMILES
- CC1=C(C=CC=C1C(F)(F)F)CN2C(=NC3=C(C=C(C=C32)N4CCOCC4)C(=O)O)C
- InChIKey
- XTKLTGBKIDQGQL-UHFFFAOYSA-N
- InChI
- 1S/C22H22F3N3O3/c1-13-15(4-3-5-18(13)22(23,24)25)12-28-14(2)26-20-17(21(29)30)10-16(11-19(20)28)27-6-8-31-9-7-27/h3-5,10-11H,6-9,12H2,1-2H3,(H,29,30)
- Synonyms
- DW94IAT0LS | J-690147 | SW219650-1 | DB11795 | GSK2636771 | GSK-2636771 | SB16472 | UNII-DW94IAT0LS | EX-A434 | FT-07...
- GSK2656157, Inhibitor of eukaryotic translation initiation factor 2 alpha kinase 3CAS: 1337532-29-2 Formula: C23H21FN6O Molecular Weight: 416.45Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US Item #: G276179View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 1-[5-(4-amino-7-methylpyrrolo[2,3-d]pyrimidin-5-yl)-4-fluoro-2,3-dihydroindol-1-yl]-2-(6-methylpyridin-2-yl)ethanone
- SMILES
- CC1=NC(=CC=C1)CC(=O)N2CCC3=C2C=CC(=C3F)C4=CN(C5=NC=NC(=C45)N)C
- InChIKey
- PRWSIEBRGXYXAJ-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- 1-[5-(4-Amino-7-methyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-4-fluoro-2,3-dihydro-1H-indol-1-yl]-2-(6-methyl-2-pyridinyl)e...
- Lixisenatide acetateCAS: 1997361-87-1 Formula: C215H347N61O65S.6C2H4O2 Molecular Weight: 4858.49（free base）● In Stock — US Item #: L275704View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L...
- Lomustine, DNA inhibitorMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US Item #: L123247View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 1-(2-chloroethyl)-3-cyclohexyl-1-nitrosourea
- SMILES
- C1CCC(CC1)NC(=O)N(CCCl)N=O
- InChIKey
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N
- InChI
- 1S/C9H16ClN3O2/c10-6-7-13(12-15)9(14)11-8-4-2-1-3-5-8/h8H,1-7H2,(H,11,14)
- Synonyms
- 3-(2-chloroethyl)-1-cyclohexyl-3-nitrosourea | NCGC00167466-01 | Prava | SCHEMBL3995 | C07079 | LOMUSTINE [HSDB] | N-...
- Lonidamine, Inhibitor of mitochondrial pyruvate carrier 1 like;Inhibitor of mitochondrial pyruvate carrier 2Solid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥99%● In Stock — US Item #: L129342View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 1-[(2,4-dichlorophenyl)methyl]indazole-3-carboxylic acid
- SMILES
- C1=CC=C2C(=C1)C(=NN2CC3=C(C=C(C=C3)Cl)Cl)C(=O)O
- InChIKey
- WDRYRZXSPDWGEB-UHFFFAOYSA-N
- InChI
- 1S/C15H10Cl2N2O2/c16-10-6-5-9(12(17)7-10)8-19-13-4-2-1-3-11(13)14(18-19)15(20)21/h1-7H,8H2,(H,20,21)
- Synonyms
- AF-1890;Diclondazolic Acid;DICA | AM20060642 | CCG-204803 | A929099 | KN-228 | Lopac-L-4900 | Diclondazolic acid | HM...
- Loperamide HCl, Mu opioid receptor agonistMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US Item #: L129465View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-N,N-dimethyl-2,2-diphenylbutanamide;hydrochloride
- SMILES
- CN(C)C(=O)C(CCN1CCC(CC1)(C2=CC=C(C=C2)Cl)O)(C3=CC=CC=C3)C4=CC=CC=C4.Cl
- InChIKey
- PGYPOBZJRVSMDS-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- Norepinephrine hydrochloride | SPECTRUM2300241 | Cardiazole | gamma-Picolinic acid | MFCD00058581 | Stomach Relief An...
- Methacrylated AlginateMethacrylation 20%-30%，molecular weight is about 50KDa● In Stock — US Item #: M301775View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- ALMA
- Methacrylated Alginate (ALMA)◐ .Made to order · 8–12 wks Item #: M398224View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- ALMA
- Methacrylated Elastin● In Stock — US Item #: M301779View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- ElaMA
- Methoxypolyethylene glycol(mPEG)average Mw 750● In Stock — US Item #: M109714View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- 2-Methoxyethanol ACS grade | 3-Oxa-1-butanol | EK1L6XWI56 | HISOLVE MC | Jeffersol EM | Monomethyl glycol | 2-methoxy...
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
How do I choose the right Applications for my synthesis route?
Work backwards from the target structure: identify the bonds you need to form, then pick the Applications entry whose functional groups, protecting-group pattern, and stereochemistry match. Compare purity, available pack sizes, and stability under your reaction conditions before committing to a route.
What does the Applications category include?
Applications covers Protein Purification and Analysis, Analytical Chemistry, Chemical synthesis, Biopharmaceuticals & Biotech and Diagnostics & Molecular Testing. If you are unsure which subcategory fits, search by structure or CAS number and the result will show where the compound sits.
What specifications matter most for Applications?
For Applications, purity is the headline figure — 95% or better is a common floor for medicinal chemistry, and higher for late-stage steps. Also check isomeric and stereochemical purity, water content for moisture-sensitive groups, storage temperature, and that the pack size matches your scale. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
What if the Applications I need is not listed?
Search Applications by CAS number or SMILES first — close analogs are often listed under a neighbouring subcategory. If nothing matches, custom synthesis and bulk enquiries go to [email protected]. We supply verified businesses, research institutions, universities, and government agencies.