GLP-2 (human) TFA salt, Agonist of GLP-2 receptor, CAS No.223460-79-5(free), Agonist of GLP-2 receptor

CAS: 223460-79-5(free) Cat. No.: G288053 Molecular Weight: 3766.14(free)
AVAILABLE TO ORDER
GRADE & PURITY Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
1mg
G288053-1mg
2
$319.90
5mg
G288053-5mg
2
$1,336.90
10mg
G288053-10mg
2
$2,057.90
25mg
G288053-25mg
2
$4,199.90
50mg
G288053-50mg
1
$5,879.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Moligand™, ≥98% Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Protected from light,Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

GLP-2(1-33) (human) TFA salt is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Specifications

Product Name
GLP-2 (human) TFA salt, Agonist of GLP-2 receptor, CAS No.223460-79-5(free)
Synonyms
Glucagon-like peptide 2 (human) | Glucagon-like peptide 2 (human) TFA | GLP-2(1-33)(human) TFA
Grade
Moligand™
Specifications & Purity
Moligand™, ≥98%
Biochemical and Physiological Mechanisms
Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gas
Sequence
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Action Type
AGONIST
Mechanism of action
Agonist of GLP-2 receptor
CAS
223460-79-5(free)
Molecule Type
Peptide
Storage and Shipping
Storage
Protected from light,Store at -20°C,Desiccated
Shipped In
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Associated Targets(Human)
GLP2R Tclin Glucagon-like peptide 2 receptor (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

10 results found

Lot NumberCertificate TypeDateItem
D2403272Certificate of AnalysisFeb 20, 2024 G288053
D2403275Certificate of AnalysisFeb 20, 2024 G288053
D2403276Certificate of AnalysisFeb 20, 2024 G288053
D2403277Certificate of AnalysisFeb 20, 2024 G288053
D2403278Certificate of AnalysisFeb 20, 2024 G288053
D2403279Certificate of AnalysisFeb 20, 2024 G288053
D2403280Certificate of AnalysisFeb 20, 2024 G288053
D2403281Certificate of AnalysisFeb 20, 2024 G288053
D2403375Certificate of AnalysisFeb 20, 2024 G288053
D2403396Certificate of AnalysisFeb 20, 2024 G288053
Genetic information
Alternate NamesGlucagon-like peptide 2 (human) | Glucagon-like peptide 2 (human) TFA | GLP-2(1-33)(human) TFA
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Moligand™ grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.