Determine the necessary mass, volume, or concentration for preparing a solution.
LL-37 acetate , CAS No.154947-66-7(free)
AVAILABLE TO ORDER
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
Why this grade
Moligand™, ≥98% Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Protected from light,Store at -20°C,Argon charged Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Overview
Product Describtion:
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing
Specifications
Product Name
LL-37 acetate , CAS No.154947-66-7(free)
Grade
Moligand™
Specifications & Purity
Moligand™, ≥98%
Biochemical and Physiological Mechanisms
Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cellsin vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also
Sequence
[LL-37, 37 aa]
CAS
154947-66-7(free)
Molecule Type
Peptide
Storage and Shipping
Storage
Protected from light,Store at -20°C,Argon charged
Shipped In
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificates（CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 F2328580 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328579 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328578 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328576 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328574 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328573 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328572 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| F2328564 | Certificate of Analysis | Apr 02, 2026 | L287236 |
| C2328776 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2329178 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2329177 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2329176 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2329175 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2329148 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2328888 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| C2328877 | Certificate of Analysis | Jan 19, 2026 | L287236 |
| I2525721 | Certificate of Analysis | Jun 27, 2025 | L287236 |
| I2525719 | Certificate of Analysis | Jun 27, 2025 | L287236 |
| I2525722 | Certificate of Analysis | Jun 27, 2025 | L287236 |
| I2525718 | Certificate of Analysis | Jun 27, 2025 | L287236 |
| F2328581 | Certificate of Analysis | Jun 02, 2023 | L287236 |
| F2328577 | Certificate of Analysis | Jun 02, 2023 | L287236 |
| C2329153 | Certificate of Analysis | Mar 14, 2023 | L287236 |
| C2328832 | Certificate of Analysis | Mar 14, 2023 | L287236 |
Show more ⌵
Documents & Articles
Solution Calculators
Reviews
Customer Reviews
Need help choosing the grade?
Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.
View Moligand™ grade guide →Related Products
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.