Recombinant Human Arginase 1/ARG1 Protein

Cat. No.: rp181581

GRADE & PURITY Carrier Free, Bioactive, His Tag, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P05089

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC50 of 35.09 ng/mL.

Overview

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Arginase is the focal enzyme of the urea cycle hydrolysing L-arginine to urea and L-ornithine. Emerging studies have identified arginase in the vasculature and have implicated this enzyme in the regulation of nitric oxide (NO) synthesis and the development of vascular disease. Arginase also redirects the metabolism of L-arginine to L-ornithine and the formation of polyamines and L-proline, which are essential for smooth muscle cell growth and collagen synthesis. Arginase is encoded by two recently discovered genes (Arginase I and Arginase II). In most mammals, Arginase 1 (ARG1) also known as Arginase, liver, which functions in the urea cycle, and is located primarily in the cytoplasm of the liver. The second isozyme, Arginase II, has been implicated in the regulation of the arginine/ornithine concentrations in the cell. It is located in mitochondria of several tissues in the body, with most abundance in the kidney and prostate. It may be found at lower levels in macrophages, lactating mammary glands, and brain.

Specifications

Product Name

Recombinant Human Arginase 1/ARG1 Protein

Synonyms

AI | ARG1 | Arginase 1 | arginase, liver | Arginase-1 | EC 3.5.3.1 | EC:3.5.3.1 | Liver Arginase | Liver-type arginase | PGIF | Type I Arginase

Grade

Bioactive, Carrier Free, His Tag

Specifications & Purity

Carrier Free, Bioactive, His-Tag, ≥90%(SDS-PAGE)

Bioactivity

Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC50 of 35.09 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

2-322 aa

Sequence

MHHHHHHSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK​

Protein Tag

N-His

Accession #

P05089

Predicted molecular weight

35.6 kDa

SDS-PAGE

35.6 kDa, under reducing conditions; 35.6 kDa, under non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Shape

Liquid

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human Arginase 1/ARG1 Protein (rp181581)

Recombinant Human Arginase 1/ARG1 Protein (rp181581) - ELISA
Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC₅₀ of 35.09 ng/mL.

SDS-PAGE: Recombinant Human Arginase 1/ARG1 Protein (rp181581)

Recombinant Human Arginase 1/ARG1 Protein (rp181581) - SDS-PAGE
3 μg/lane of Recombinant Human Arginase 1/ARG1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.6 kDa.