Recombinant Human Arginase 1/ARG1 Protein

Cat. No.: rp181581
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P05089
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC50 of 35.09 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp181581-10μg
≥10
$175.90
50μg
rp181581-50μg
10
$679.90
100μg
rp181581-100μg
10
$1,119.90
1mg
rp181581-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,His-Tag,≥90%(SDS-PAGE) Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Arginase is the focal enzyme of the urea cycle hydrolysing L-arginine to urea and L-ornithine. Emerging studies have identified arginase in the vasculature and have implicated this enzyme in the regulation of nitric oxide (NO) synthesis and the development of vascular disease. Arginase also redirects the metabolism of L-arginine to L-ornithine and the formation of polyamines and L-proline, which are essential for smooth muscle cell growth and collagen synthesis. Arginase is encoded by two recently discovered genes (Arginase I and Arginase II). In most mammals, Arginase 1 (ARG1) also known as Arginase, liver, which functions in the urea cycle, and is located primarily in the cytoplasm of the liver. The second isozyme, Arginase II, has been implicated in the regulation of the arginine/ornithine concentrations in the cell. It is located in mitochondria of several tissues in the body, with most abundance in the kidney and prostate. It may be found at lower levels in macrophages, lactating mammary glands, and brain.

Specifications

Product Name
Recombinant Human Arginase 1/ARG1 Protein
Synonyms
AI | ARG1 | Arginase 1 | arginase, liver | Arginase-1 | EC 3.5.3.1 | EC:3.5.3.1 | Liver Arginase | Liver-type arginase | PGIF | Type I Arginase
Grade
Bioactive, Carrier Free, His Tag
Specifications & Purity
Carrier Free, Bioactive, His-Tag, ≥90%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC50 of 35.09 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
2-322 aa
Sequence
MHHHHHHSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK​
Protein Tag
N-His
Accession #
Predicted molecular weight
35.6 kDa
SDS-PAGE
35.6 kDa, under reducing conditions; 35.6 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Liquid
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Arginase 1/ARG1 Protein (rp181581) - ELISA
Immobilized Recombinant Human Arginase 1/ARG1 Protein (rp181581) at 1.0 μg/mL can bind Liver Arginase Mouse mAb (Ab113273) with the EC₅₀ of 35.09 ng/mL.

Recombinant Human Arginase 1/ARG1 Protein (rp181581) - SDS-PAGE
3 μg/lane of Recombinant Human Arginase 1/ARG1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.6 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0606800Certificate of AnalysisJun 12, 2024 rp181581
ZJ24F0606799Certificate of AnalysisJun 12, 2024 rp181581
ZJ24F0606798Certificate of AnalysisJun 12, 2024 rp181581
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Bioactive grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.