Recombinant Human IL-36 alpha/IL-1F6 Protein

Cat. No.: rp184956
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q9UHA7
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 0.73 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp184956-10μg
7
$227.90
50μg
rp184956-50μg
4
$667.90
100μg
rp184956-100μg
4
$1,067.90
1mg
rp184956-1mg
1
$4,449.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, ActiBioPure™, High Performance, Bioactive, ≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-36 alpha/IL-1F6 Protein
Synonyms
FIL1 epsilon | FIL1 | FIL1(EPSILON) | FIL1E | IL-1 epsilon | IL1(EPSILON) | IL1E | IL-1E | IL-1F6 (FIL-1-epsilon) | IL1F6 | IL-1F6 | IL36 alpha | IL-36 alpha | IL36A | interleukin 1 family, member 6 (epsilon) | interleukin 1, epsilon | Interleukin 36, Alp
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity
Carrier Free, ActiBioPure™, High Performance, Bioactive, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Human IL-36 alpha, previously called IL-1F6 and FIL1 epsilon (family of IL-1 member epsilon), is a member of the IL-1 family which includes IL-1 beta, IL-1 alpha, IL-1ra, IL-18, and novel family members IL-36 Ra (IL-1F5), IL-36 beta (IL-1F8), IL-36 gamma
Bioactivity
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 0.73 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
6-158 aa
Sequence
KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF​
Protein Tag
No tag
Accession #
Predicted molecular weight
17.1 kDa
SDS-PAGE
14.2 kDa, under reducing conditions; 14.1 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human IL-36 alpha/IL-1F6 Protein (rp184956) - SDS-PAGE
3 μg/lane of Recombinant Human IL-36 alpha/IL-1F6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.2 kDa under reducing conditions and 14.1 kDa under non-reducing conditions.

Recombinant Human IL-36 alpha/IL-1F6 Protein (rp184956) - Protein Bioactivity
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 0.73 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F1011714Certificate of AnalysisMay 21, 2026 rp184956
ZJ24F1011715Certificate of AnalysisMay 21, 2026 rp184956
ZJ24F1011716Certificate of AnalysisMay 21, 2026 rp184956
ZJ24F1011717Certificate of AnalysisMay 21, 2026 rp184956
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.