Recombinant Human SARS-CoV-2 Spike Protein RBD, ＞95% (SDS-PAGE)

Cat. No.: rp155929

Skip to the end of the images gallery

Recombinant Human SARS-CoV-2 Spike Protein RBD - by Aladdin Scientific

Skip to the beginning of the images gallery

AVAILABLE TO ORDER

GRADE & PURITY Animal Free ? Carrier Free ? Bioactive ? ActiBioPure™ ? His Tag ? PBS Only ? ≥95%(SDS-PAGE) See COA

Expression System

HEK293

Accession #

P0DTC2

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

1. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 5.0 μg/mL can bind Recombinant Human ACE-2 Protein (rp176242) with the EC50 of 75.79 ng/mL. 2. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 1.0 μg/mL can bind Regdanvimab (anti-Spike RBD) (Ab182925) with the EC50 of 12.65 ng/mL. 3. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 1.0 μg/mL can bind Imdevimab (anti-Spike RBD) (Ab182897) with the EC50 of 7.82 ng/mL. 4. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 1.0 μg/mL can bind Etesevimab (anti-Spike RBD) (Ab182932) with the EC50 of 23.96 ng/mL. 5. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 1.0 μg/mL can bind Sotrovimab (anti-Spike RBD) (Ab182938) with the EC50 of 41.33 ng/mL. 6. Immobilized Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) at 1.0 μg/mL can bind Casirivimab (anti-Spike RBD) (Ab182896) with the EC50 of 10.50 ng/mL.

Overview Specifications Storage and Shipping Images Documentation Advanced Data Certificates（CoA,COO,BSE/TSE and Analysis Chart) Solution Calculators Reviews

🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4; APN, aminopeptidase N; CEACAM, carcinoembryonic antigen-related cell adhesion molecule 1; Sia, sialic acid; O-ac Sia, O-acetylated sialic acid. The spike is essential for both host specificity and viral infectivity. The term 'peplomer' is typically used to refer to a grouping of heterologous proteins on the virus surface that function together. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. It's been reported that SARS-CoV-2 (COVID-19 coronavirus, 2019-nCoV) can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion; Defines the range of the hosts and specificity of the virus; Main component to bind with the neutralizing antibody; Key target for vaccine design; Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate.

Specifications

Product Name

Recombinant Human SARS-CoV-2 Spike Protein RBD, ＞95% (SDS-PAGE)

Synonyms

SARS-CoV-2 RBD Protein | SARS-CoV-2 Spike RBD Protein | SARS-CoV-2 S Protein RBD

Grade

ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA

Purity

＞95% (SDS-PAGE)

Bioactivity

Endotoxin Concentration

<1.0 EU/μg

Expression System

HEK293

Species

SARS-CoV-2

Amino Acids

319-541 aa

Sequence

MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFENLYFQGHHHHHH

Protein Tag

C-His

Accession #

P0DTC2

Predicted molecular weight

26.9 kDa

SDS-PAGE

36.4 kDa, reducing conditions; 34.2 kDa, non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Shape

Liquid

Concentration

See COA

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929)

Recombinant Human SARS-CoV-2 Spike Protein RBD (rp155929) - SDS-PAGE
3 μg/lane of Recombinant Human SARS-CoV-2 Spike Protein RBD was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 36.4 kDa under reducing conditions and 34.2 kDa under non-reducing conditions.