Recombinant Mouse Lumican Protein

Cat. No.: rp167235
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P51885
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of BCE C/D‑1b bovine corneal endothelial cells. When 5 x 10^4 cells per well are added to rmLumican coated plates (10 μg/mL, 100 μL/well) ≥ 50% will adhere after 50 minutes at 37 ℃.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp167235-10μg
5
$159.90
50μg
rp167235-50μg
3
$477.90
100μg
rp167235-100μg
1
$763.90
1mg
rp167235-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,349.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Background
Lumican is a 40 kDa member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily. Mouse Lumican is synthesized as a 338 amino acid (aa) precursor that contains an 18 aa signal sequence and a 320 aa mature chain (SwissProt #: 51885). The mature chain contains a negatively charged N-terminal domain containing sulfated tyrosine and disulfide bonds, 12 leucine-rich repeats (LRRs), four potential sites of N-linked glycosylation, and a carboxyl terminal domain containing two conserved cysteines. Mature mouse Lumican is 98%, 88%, and 70% aa identical to mature rat, human, and chick Lumican, respectively. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins (ECM) proteins. Lumican is expressed in a variety of tissues, including skin, artery, lung, cornea, kidney, bone, aorta, and articular cartilage. Lumican’s rolein vivohas been found using Lumican null mice. These mice have functional deficits including corneal opacity as well as skin and tendon fragility associated with disorganized and loosely packed collagen fibers. The abnormal connective tissue phenotype seen in the Lumican null mice shows the importance of the role of Lumican in collagen fibrillogenesis. In addition to the control of collagen fibril assembly, Lumican has been shown to play a role in the regulation of cell proliferation, migration, and adhesion. Lumican’s overexpression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers.

Specifications

Product Name
Recombinant Mouse Lumican Protein
Synonyms
KSPG lumican | LDC | LUM | lumican proteoglycan | Lumican | SLRR2D | Keratan sulfate proteoglycan lumican
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE)
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of BCE C/D‑1b bovine corneal endothelial cells. When 5 x 10^4 cells per well are added to rmLumican coated plates (10 μg/mL, 100 μL/well) ≥ 50% will adhere after 50 minutes at 37 ℃.
Endotoxin Concentration
<0.1 EU/μg
Expression System
HEK293
Amino Acids
19-338 aa
Sequence
QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVNHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
37.3 kDa
SDS-PAGE
40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Mouse Lumican Protein (rp167235) - SDS-PAGE
2 μg/lane of Recombinant Mouse Lumican Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.