Recombinant Protein A-Cys, Long Form, CAS No.91932-65-9

CAS: 91932-65-9 Cat. No.: rp224629 EC Number: 295-242-9 PubChem CID: 363902062

GRADE & PURITY Animal Free, Carrier Free, ≥97%(SDS-PAGE)

Accession #

E5R5N7

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<0.1 EU/μg

Overview

Protein A is a cell wall component produced by several strains of Staphylococcus aureus that consists of a single polypeptide chain and contains little or no carbohydrate. Recombinant Protein A is produced in E.Coli and functions essentially the same as native Protein A. It consists of 5 IgG-binding domains E-D-A-B-C aligned in series.
Specificity: The recombinant Protein A is a genetically engineered protein containing 5 IgG-binding regions of protein A. The recombinant Protein A is ideal for purification of polyclonal or monoclonal IgG antibodies. Protein A binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2c). It also binds to total IgG from rabbit, guinea pig, pig, dog and cat.

Specifications

Product Name

Recombinant Protein A-Cys, Long Form, CAS No.91932-65-9

Synonyms

Recombinant Protein A, Long Form | Protein A | Staphylococcal Protein A | Staphylococcal Protein A Recombinant | Immunoglobulin G-binding protein A | gG-binding protein A | Immunoglobulin G binding protein A | SPA | ECTR2_67

Grade

Animal Free, Carrier Free

Specifications & Purity

Animal Free, Carrier Free, ≥97%(SDS-PAGE)

Endotoxin Concentration

<0.1 EU/μg

Amino Acids

37-458 aa

Sequence

AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDC

Accession #

E5R5N7

Predicted molecular weight

46.7 kDa

SDS-PAGE

46.7 kDa

CAS

91932-65-9

Molecule Type

Protein

Storage and Shipping

Reconstitution

Dissolve in distilled water or saline.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20~-70℃ long term (12 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. 

References

1. Li Yangyang, Zhu Zhengwei, Qu Wenli, Yang Qing, Liu Yan, Wang Qiao, Duan Shuo, Wu Jine, Gong Zhiyong, Xu Lin.  (2023)  A highly sensitive immunochromatographic assay for lead ions in drinking water based on antibody-oriented probe and silver enhancement.  EUROPEAN FOOD RESEARCH AND TECHNOLOGY,  249  (12): (3097-3103).  [PMID:] [10.1007/s00217-023-04351-5]

2. Jin Li, Xintong Li, Yulian Wang, Qianxu Zhou, Guoqing Shi.  (2024)  Utilization of Fc-specific peptide to orientally immobilize antibodies markedly improves the analytical performance of lateral flow immunoassay strips for aflatoxin B1.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2024.112404]

3. Shuo Yang, Jinglong Qu, Yang Qin, Shuaibing An, Kaiqiang Huang, Yaling Wei, Jun Xi.  (2026)  Enhanced ultra-sensitive detection of peanut allergen Ara h 3 on immunochromatographic paper based on surface-enhanced Raman spectroscopy and AuNBs@PDA dual signal amplification strategy.  FOOD CHEMISTRY,      [PMID:41638166] [10.1016/j.foodchem.2026.148209]

4. Pan Cheng, Chuang Zhang, Xiupu Lu, Daiqing Peng, Pengju Zhao, Tao Mei, Shunxing Zhang, Qihao Guo, Ke Liu, Dong Wang.  (2026)  Protein A functionalized hierarchically ordered nanofibrous sponge enabling high-efficiency IgG purification.  COLLOIDS AND SURFACES A-PHYSICOCHEMICAL AND ENGINEERING ASPECTS,      [PMID:] [10.1016/j.colsurfa.2026.140254]