224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Peptidyl-prolyl cis-trans isomerase F, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 10105 |
|---|---|
| Uniprot Accession IDs | P30405 Q2YDB7 Q5W131 PPIase F |
| Ensembl ID | ENSP00000225174 |
| Symbol | CYP3 CYP3 CypD CyP-M Cyp-D |
| Family | Belongs to the cyclophilin-type PPIase family. |
| Sequence | MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450545 | PPIF | peptidylprolyl isomerase F | 9598 | VGNC:7857 | OMA, EggNOG |
| Macaque | 574137 | PPIF | peptidylprolyl isomerase F | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 105675 | Ppif | peptidylprolyl isomerase F (cyclophilin F) | 10090 | MGI:2145814 | Inparanoid, OMA, EggNOG |
| Rat | 282819 | Ppif | peptidylprolyl isomerase F | 10116 | RGD:628670 | Inparanoid, OMA, EggNOG |
| Horse | 100073016 | PPIF | peptidylprolyl isomerase F | 9796 | VGNC:21731 | Inparanoid, OMA, EggNOG |
| Cow | 414346 | PPIF | peptidylprolyl isomerase F | 9913 | VGNC:33198 | Inparanoid, OMA, EggNOG |
| Pig | 100152612 | PPIF | peptidylprolyl isomerase F | 9823 | OMA, EggNOG | |
| Opossum | 100014702 | PPIF | peptidylprolyl isomerase F | 13616 | Inparanoid, EggNOG | |
| Platypus | 100073904 | PPIF | peptidylprolyl isomerase F | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423723 | PPIF | peptidylprolyl isomerase F | 9031 | CGNC:52036 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563752 | ppif | peptidylprolyl isomerase F | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394470 | ppia | peptidylprolyl isomerase A (cyclophilin A) | 8364 | XB-GENE-5778000 | Inparanoid, EggNOG |
| Zebrafish | 641328 | ppifb | peptidylprolyl isomerase Fb | 7955 | ZDB-GENE-051030-126 | Inparanoid, EggNOG |
| C. elegans | 180027 | cyn-7 | Peptidyl-prolyl cis-trans isomerase 7 | 6239 | OMA, EggNOG | |
| Fruitfly | 39573 | CG7768 | CG7768 gene product from transcript CG7768-RA | 7227 | FBgn0036415 | Inparanoid, EggNOG |
| S.cerevisiae | 851733 | CPR1 | peptidylprolyl isomerase CPR1 | 4932 | S000002562 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.