🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PPIH

DescriptionPeptidyl-prolyl cis-trans isomerase H

Gene and Protein Information

Gene ID10465
Uniprot Accession IDs O43447 A6NNE7 PPIase H
Ensembl ID ENSP00000306614
Symbol CYP20 CYPH CYPH CYP-20 USA-CYP SnuCyp-20
FamilyBelongs to the cyclophilin-type PPIase family. PPIase H subfamily.
Sequence
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469303PPIHpeptidylprolyl isomerase H9598VGNC:6959OMA, EggNOG
Macaque697669PPIHpeptidylprolyl isomerase H9544Inparanoid, OMA, EggNOG
Mouse66101Ppihpeptidyl prolyl isomerase H10090MGI:106499Inparanoid, OMA, EggNOG
Rat366461Ppihpeptidylprolyl isomerase H10116RGD:1564921Inparanoid, OMA, EggNOG
Dog606899PPIHpeptidylprolyl isomerase H9615VGNC:44854Inparanoid, OMA, EggNOG
Horse100053643PPIHpeptidylprolyl isomerase H9796VGNC:21733Inparanoid, OMA, EggNOG
Cow513428PPIHpeptidylprolyl isomerase H9913VGNC:33200Inparanoid, OMA, EggNOG
Pig100523448PPIHpeptidylprolyl isomerase H9823Inparanoid, OMA, EggNOG
Opossum100032668PPIHpeptidylprolyl isomerase H13616Inparanoid, OMA, EggNOG
Chicken419507PPIHpeptidylprolyl isomerase H9031CGNC:3618Inparanoid, OMA, EggNOG
Xenopus394997ppihpeptidylprolyl isomerase H8364XB-GENE-485863Inparanoid, OMA, EggNOG
Zebrafish494165ppihpeptidylprolyl isomerase H (cyclophilin H)7955ZDB-GENE-040625-127Inparanoid, OMA, EggNOG
C. elegans174394cyn-11Peptidyl-prolyl cis-trans isomerase 116239Inparanoid, OMA
Fruitfly35571CG17266CG17266 gene product from transcript CG17266-RA7227FBgn0033089Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.