🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PHPT1

Description14 kDa phosphohistidine phosphatase

Gene and Protein Information

Gene ID29085
Uniprot Accession IDs Q9NRX4 B1AMX0 B1AMX1 Q9H0Y3
Ensembl ID ENSP00000247665
Symbol PHP14 PHP PHP14 CGI-202 HSPC141 HEL-S-132P
FamilyBelongs to the janus family.
Sequence
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse75454Phpt1phosphohistidine phosphatase 110090MGI:1922704Inparanoid, OMA, EggNOG
Rat296571Phpt1phosphohistidine phosphatase 110116RGD:1311355Inparanoid, OMA, EggNOG
Dog491245PHPT1phosphohistidine phosphatase 19615VGNC:44509Inparanoid, OMA, EggNOG
Cow618691PHPT1phosphohistidine phosphatase 19913VGNC:32846Inparanoid, OMA, EggNOG
Opossum100017116PHPT1phosphohistidine phosphatase 113616Inparanoid, EggNOG
Anole lizard100558315phpt1phosphohistidine phosphatase 128377Inparanoid, OMA, EggNOG
Xenopus100497662phpt1phosphohistidine phosphatase 18364XB-GENE-979475Inparanoid, OMA, EggNOG
Zebrafish445172phpt1phosphohistidine phosphatase 17955ZDB-GENE-040801-85Inparanoid, OMA
C. elegans185336phip-1Protein HIstidine Phosphatase6239Inparanoid, OMA
Fruitfly43569janAjanus A7227FBgn0001280Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.