224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Phosphoglycerate mutase 1 |
|---|
Gene and Protein Information
| Gene ID | 5223 |
|---|---|
| Uniprot Accession IDs | P18669 Q9BWC0 |
| Ensembl ID | ENSP00000359991 |
| Symbol | PGAMA PGAMA PGAM-B HEL-S-35 |
| Family | Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily. |
| Sequence | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450650 | PGAM1 | phosphoglycerate mutase 1 | 9598 | VGNC:12419 | OMA, EggNOG |
| Macaque | 706211 | PGAM1 | phosphoglycerate mutase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18648 | Pgam1 | phosphoglycerate mutase 1 | 10090 | MGI:97552 | Inparanoid, OMA, EggNOG |
| Rat | 24642 | Pgam1 | phosphoglycerate mutase 1 | 10116 | RGD:3312 | Inparanoid, OMA, EggNOG |
| Cow | 404148 | PGAM1 | phosphoglycerate mutase 1 | 9913 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.