RAB24

DescriptionRas-related protein Rab-24

Gene and Protein Information

Gene ID53917
Uniprot Accession IDs Q969Q5 A0A024R7N9 Q7Z4Z7
Ensembl ID ENSP00000304376
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471755RAB24RAB24, member RAS oncogene family9598VGNC:8633OMA, EggNOG
Macaque698876RAB24RAB24, member RAS oncogene family9544OMA, EggNOG
Mouse19336Rab24RAB24, member RAS oncogene family10090MGI:105065Inparanoid, OMA, EggNOG
Dog479277RAB24RAB24, member RAS oncogene family9615VGNC:45264Inparanoid, OMA, EggNOG
Horse100058530RAB24RAB24, member RAS oncogene family9796VGNC:22097Inparanoid, OMA, EggNOG
Cow617635RAB24RAB24, member RAS oncogene family9913VGNC:33631Inparanoid, OMA, EggNOG
Pig100511865RAB24RAB24, member RAS oncogene family9823Inparanoid, OMA, EggNOG
Opossum100027665RAB24RAB24, member RAS oncogene family13616Inparanoid, EggNOG
Chicken427627RAB24RAB24, member RAS oncogene family9031CGNC:2157Inparanoid, OMA, EggNOG
Anole lizard100563654rab24RAB24, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus548925rab24RAB24, member RAS oncogene family8364XB-GENE-491489Inparanoid, OMA, EggNOG
Zebrafish574423rab24RAB24, member RAS oncogene family7955ZDB-GENE-050706-110Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.