🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RAB21

DescriptionRas-related protein Rab-21

Gene and Protein Information

Gene ID23011
Uniprot Accession IDs Q9UL25 Q14466 Q569H3
Ensembl ID ENSP00000261263
Symbol KIAA0118
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467069RAB21RAB21, member RAS oncogene family9598VGNC:13352OMA, EggNOG
Mouse216344Rab21RAB21, member RAS oncogene family10090MGI:894308Inparanoid, OMA, EggNOG
Rat299799Rab21RAB21, member RAS oncogene family10116RGD:1303150Inparanoid, OMA, EggNOG
Dog100683312RAB21RAB21, member RAS oncogene family9615VGNC:45261Inparanoid, OMA, EggNOG
Horse100056811RAB21RAB21, member RAS oncogene family9796VGNC:22094Inparanoid, OMA, EggNOG
Cow781001RAB21RAB21, member RAS oncogene family9913VGNC:33628Inparanoid, OMA, EggNOG
Platypus100087487RAB21RAB21, member RAS oncogene family9258OMA, EggNOG
Chicken771383RAB21RAB21, member RAS oncogene family9031CGNC:7744Inparanoid, OMA, EggNOG
Anole lizard100551608rab21RAB21, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus549073rab21RAB21, member RAS oncogene family8364XB-GENE-486436Inparanoid, OMA, EggNOG
Zebrafish767727zgc:154045zgc:1540457955ZDB-GENE-060929-1062Inparanoid, OMA
C. elegans187932rab-21RAB family6239Inparanoid, OMA
Fruitfly3355163Rab21CG17515 gene product from transcript CG17515-RD7227FBgn0039966Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.