🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PDCD6

DescriptionProgrammed cell death protein 6

Gene and Protein Information

Gene ID10016
Uniprot Accession IDs O75340 B2RD16 E7ESR3 Q2YDC2 Q5TZS0
Ensembl ID ENSP00000264933
Symbol ALG2 ALG2 ALG-2 PEF1B
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471813PDCD6programmed cell death 69598VGNC:4123OMA, EggNOG
Mouse18570Pdcd6programmed cell death 610090MGI:109283Inparanoid, OMA, EggNOG
Rat308061Pdcd6programmed cell death 610116RGD:1311239Inparanoid, OMA, EggNOG
Dog609549PDCD6programmed cell death 69615VGNC:44340Inparanoid, OMA, EggNOG
HorsePDCD6programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765]9796OMA, EggNOG
Cow100125927PDCD6programmed cell death 69913VGNC:32663Inparanoid, OMA, EggNOG
Opossum100011306PDCD6programmed cell death 613616Inparanoid, OMA, EggNOG
Chicken420988PDCD6programmed cell death 69031CGNC:10082Inparanoid, OMA, EggNOG
Xenopus493366pdcd6programmed cell death 68364XB-GENE-960916Inparanoid, OMA, EggNOG
Zebrafish393925pdcd6programmed cell death 67955ZDB-GENE-040426-1307Inparanoid, OMA, EggNOG
C. elegans187448M04F3.4hypothetical protein6239OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.