🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

COX6B1

DescriptionCytochrome c oxidase subunit 6B1

Gene and Protein Information

Gene ID1340
Uniprot Accession IDs P14854 B2R5C9 Q6IBL4
Ensembl ID ENSP00000246554
Symbol COX6B COXG COX6B COXVIb1
FamilyBelongs to the cytochrome c oxidase subunit 6B family.
Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp745426COX6B1cytochrome c oxidase subunit 6B19598VGNC:7610OMA, EggNOG
Macaque692062COX6B1cytochrome c oxidase subunit 6B9544Inparanoid, OMA, EggNOG
Mouse110323Cox6b1cytochrome c oxidase, subunit VIb polypeptide 110090MGI:107460Inparanoid, OMA, EggNOG
RatCox6b1cytochrome c oxidase subunit 6B1 [Source:RGD Symbol;Acc:1584097]10116OMA, EggNOG
Dog612644LOC612644cytochrome c oxidase subunit 6B19615Inparanoid, OMA, EggNOG
Horse100051249COX6B1cytochrome c oxidase subunit 6B19796VGNC:16807Inparanoid, OMA, EggNOG
Pig100038022COX6BCOX6B protein9823Inparanoid, OMA, EggNOG
Opossum100013297LOC100013297cytochrome c oxidase subunit 6B113616OMA, EggNOG
Anole lizard100554634LOC100554634cytochrome c oxidase subunit 6B128377OMA, EggNOG
Zebrafish436968cox6b1cytochrome c oxidase subunit VIb polypeptide 17955ZDB-GENE-040718-448OMA, EggNOG
Zebrafish393478cox6b2cytochrome c oxidase subunit VIb polypeptide 27955ZDB-GENE-040426-1566Inparanoid, OMA
S.cerevisiae850727COX12cytochrome c oxidase subunit VIb4932S000004028OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.