224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Peflin |
|---|
Gene and Protein Information
| Gene ID | 553115 |
|---|---|
| Uniprot Accession IDs | Q9UBV8 |
| Ensembl ID | ENSP00000362807 |
| Symbol | ABP32 ABP32 PEF1A |
| Sequence | MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456701 | PEF1 | penta-EF-hand domain containing 1 | 9598 | VGNC:9381 | OMA, EggNOG |
| Mouse | 67898 | Pef1 | penta-EF hand domain containing 1 | 10090 | MGI:1915148 | Inparanoid, OMA, EggNOG |
| Rat | 297900 | Pef1 | penta-EF hand domain containing 1 | 10116 | RGD:1359536 | Inparanoid, OMA, EggNOG |
| Dog | 611885 | PEF1 | penta-EF-hand domain containing 1 | 9615 | VGNC:44412 | Inparanoid, OMA, EggNOG |
| Horse | 100056122 | PEF1 | penta-EF-hand domain containing 1 | 9796 | VGNC:21303 | Inparanoid, OMA |
| Cow | 506928 | PEF1 | penta-EF-hand domain containing 1 | 9913 | VGNC:32739 | Inparanoid, OMA, EggNOG |
| Opossum | 100032172 | PEF1 | penta-EF-hand domain containing 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | PEF1 | penta-EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30009] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100560143 | pef1 | penta-EF-hand domain containing 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100144965 | pef1 | penta-EF-hand domain containing 1 | 8364 | XB-GENE-1013238 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445249 | pef1 | penta-EF-hand domain containing 1 | 7955 | ZDB-GENE-040801-259 | Inparanoid, OMA, EggNOG |
| Fruitfly | 36111 | CG17765 | CG17765 gene product from transcript CG17765-RA | 7227 | FBgn0033529 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.