224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Phosducin-like protein 3 |
|---|
Gene and Protein Information
| Gene ID | 79031 |
|---|---|
| Uniprot Accession IDs | Q9H2J4 B2RA00 Q53S68 |
| Ensembl ID | ENSP00000264254 |
| Symbol | PhLP2A VIAF1 VIAF PHLP3 VIAF1 HTPHLP PHLP2A |
| Family | Belongs to the phosducin family. |
| Sequence | MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 68833 | Pdcl3 | phosducin-like 3 | 10090 | MGI:1916083 | Inparanoid, OMA, EggNOG |
| Rat | 316348 | Pdcl3 | phosducin-like 3 | 10116 | RGD:1309663 | Inparanoid, OMA, EggNOG |
| Dog | 474553 | PDCL3 | phosducin like 3 | 9615 | VGNC:44344 | Inparanoid, OMA, EggNOG |
| Horse | 100059384 | PDCL3 | phosducin like 3 | 9796 | VGNC:21236 | Inparanoid, OMA, EggNOG |
| Cow | 514033 | PDCL3 | phosducin like 3 | 9913 | VGNC:32667 | Inparanoid, OMA, EggNOG |
| Opossum | 100015433 | PDCL3 | phosducin like 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | PDCL3 | phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860] | 9258 | OMA, EggNOG | ||
| Chicken | 418709 | PDCL3 | phosducin like 3 | 9031 | CGNC:12579 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562180 | pdcl3 | phosducin like 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496850 | pdcl3 | phosducin like 3 | 8364 | XB-GENE-5737550 | Inparanoid, OMA, EggNOG |
| Fruitfly | 39364 | viaf | viral IAP-associated factor | 7227 | FBgn0036237 | OMA, EggNOG |
| S.cerevisiae | 854456 | PLP2 | Plp2p | 4932 | S000005807 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.