🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RAMP3

DescriptionReceptor activity-modifying protein 3

Gene and Protein Information

Gene ID10268
Uniprot Accession IDs O60896 Q7Z2Y1
Ensembl ID ENSP00000242249
FamilyBelongs to the RAMP family.
Sequence
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp739151RAMP3receptor activity modifying protein 39598VGNC:14081OMA, EggNOG
Mouse56089Ramp3receptor (calcitonin) activity modifying protein 310090MGI:1860292Inparanoid, OMA, EggNOG
Rat56820Ramp3receptor activity modifying protein 310116RGD:61873Inparanoid, OMA
Dog100855938RAMP3receptor activity modifying protein 39615VGNC:54348Inparanoid, OMA, EggNOG
HorseRAMP3receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845]9796OMA, EggNOG
Cow613547RAMP3receptor activity modifying protein 39913VGNC:33708Inparanoid, OMA, EggNOG
Opossum100030491RAMP3receptor activity modifying protein 313616Inparanoid, OMA, EggNOG
PlatypusRAMP3receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845]9258OMA, EggNOG
Anole lizard100555378ramp3receptor activity modifying protein 328377Inparanoid, OMA, EggNOG
Xenopusramp3receptor (G protein-coupled) activity modifying protein 3 [Source:Xenbase;Acc:XB-GENE-983292]8364OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.