🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PDGFC

DescriptionPlatelet-derived growth factor C

Gene and Protein Information

Gene ID56034
Uniprot Accession IDs Q9NRA1 B4DU34 B9EGR8 Q4W5M9 Q9UL22 PDGF-C
Ensembl ID ENSP00000422464
Symbol SCDGF SCDGF FALLOTEIN
FamilyBelongs to the PDGF/VEGF growth factor family.
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736477PDGFCplatelet derived growth factor C9598VGNC:657OMA, EggNOG
Macaque700236PDGFCplatelet derived growth factor C9544Inparanoid, OMA, EggNOG
Mouse54635Pdgfcplatelet-derived growth factor, C polypeptide10090MGI:1859631Inparanoid, OMA, EggNOG
Rat79429Pdgfcplatelet derived growth factor C10116RGD:68410Inparanoid, OMA, EggNOG
Dog482666PDGFCplatelet derived growth factor C9615VGNC:44370Inparanoid, OMA, EggNOG
Horse100062015PDGFCplatelet derived growth factor C9796VGNC:21259Inparanoid, OMA, EggNOG
Cow613787PDGFCplatelet derived growth factor C9913VGNC:53915Inparanoid, OMA, EggNOG
Pig100515267PDGFCplatelet derived growth factor C9823OMA, EggNOG
Opossum100023701PDGFCplatelet derived growth factor C13616Inparanoid, OMA, EggNOG
Platypus100079757PDGFCplatelet derived growth factor C9258Inparanoid, OMA, EggNOG
Chicken395469PDGFCplatelet derived growth factor C9031CGNC:7129Inparanoid, OMA, EggNOG
Anole lizard100568114pdgfcplatelet derived growth factor C28377Inparanoid, OMA, EggNOG
Xenopus100494492pdgfcplatelet derived growth factor C8364XB-GENE-985688Inparanoid, OMA, EggNOG
Zebrafish560564pdgfcplatelet derived growth factor c7955ZDB-GENE-071217-2OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Platelet-derived growth factor C
DTO Classes
protein    /    Signaling    /    Growth factor    /    Platelet-derived growth factor C

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.