224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone-binding protein RBBP7 |
|---|
Gene and Protein Information
| Gene ID | 5931 |
|---|---|
| Uniprot Accession IDs | Q16576 Q5JP00 |
| Ensembl ID | ENSP00000369424 |
| Symbol | RBAP46 RbAp46 |
| Family | Belongs to the WD repeat RBAP46/RBAP48/MSI1 family. |
| Sequence | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465518 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9598 | VGNC:1203 | Inparanoid, OMA, EggNOG |
| Macaque | 713843 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9544 | Inparanoid, OMA | |
| Mouse | 245688 | Rbbp7 | retinoblastoma binding protein 7, chromatin remodeling factor | 10090 | MGI:1194910 | Inparanoid, OMA |
| Rat | 83712 | Rbbp7 | RB binding protein 7, chromatin remodeling factor | 10116 | RGD:620125 | Inparanoid, OMA |
| Dog | 480854 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9615 | VGNC:45393 | Inparanoid, OMA |
| Horse | 100056761 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9796 | VGNC:22221 | Inparanoid, OMA |
| Cow | 537402 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9913 | VGNC:33772 | Inparanoid, OMA |
| Opossum | 100016649 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 13616 | Inparanoid, OMA | |
| Platypus | 100085544 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9258 | Inparanoid, OMA | |
| Chicken | 395390 | RBBP7 | RB binding protein 7, chromatin remodeling factor | 9031 | CGNC:12390 | Inparanoid, OMA |
| Xenopus | 394900 | rbbp7 | retinoblastoma binding protein 7 | 8364 | XB-GENE-487909 | Inparanoid, OMA, EggNOG |
| C. elegans | 172802 | lin-53 | Probable histone-binding protein lin-53 | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856654 | HAT2 | Hat2p | 4932 | S000000782 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.