224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | GTPase ERas |
|---|
Gene and Protein Information
| Gene ID | 3266 |
|---|---|
| Uniprot Accession IDs | Q7Z444 E-Ras |
| Ensembl ID | ENSP00000339136 |
| Symbol | HRAS2 HRASP HRAS2 HRASP |
| Family | Belongs to the small GTPase superfamily. Ras family. |
| Sequence | MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 711442 | ERAS | ES cell expressed Ras | 9544 | Inparanoid, OMA | |
| Mouse | 353283 | Eras | ES cell-expressed Ras | 10090 | MGI:2665023 | Inparanoid, OMA |
| Dog | 491869 | ERAS | ES cell expressed Ras | 9615 | VGNC:40435 | Inparanoid, OMA |
| Horse | 100062317 | ERAS | ES cell expressed Ras | 9796 | VGNC:17648 | Inparanoid, OMA |
| Cow | 540065 | ERAS | ES cell expressed Ras | 9913 | VGNC:28562 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.