224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Dual specificity protein phosphatase 3 |
|---|
Gene and Protein Information
| Gene ID | 1845 |
|---|---|
| Uniprot Accession IDs | P51452 D3DX45 Q5U0J1 Q8IYJ9 |
| Ensembl ID | ENSP00000226004 |
| Symbol | VHR VHR |
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
| Sequence | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468271 | DUSP3 | dual specificity phosphatase 3 | 9598 | VGNC:12093 | OMA, EggNOG |
| Macaque | 713686 | DUSP3 | dual specificity phosphatase 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 72349 | Dusp3 | dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related) | 10090 | MGI:1919599 | Inparanoid, OMA, EggNOG |
| Rat | 498003 | Dusp3 | dual specificity phosphatase 3 | 10116 | RGD:1560049 | Inparanoid, OMA, EggNOG |
| Dog | 480505 | DUSP3 | dual specificity phosphatase 3 | 9615 | VGNC:53236 | Inparanoid, OMA, EggNOG |
| Horse | 100064999 | DUSP3 | dual specificity phosphatase 3 | 9796 | VGNC:51807 | Inparanoid, OMA, EggNOG |
| Cow | 615432 | DUSP3 | dual specificity phosphatase 3 | 9913 | VGNC:28259 | Inparanoid, OMA, EggNOG |
| Pig | 100512983 | DUSP3 | dual specificity phosphatase 3 | 9823 | OMA, EggNOG | |
| Opossum | DUSP3 | dual specificity phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:3069] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | 100555344 | dusp3 | dual specificity phosphatase 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 100000665 | dusp3a | dual specificity phosphatase 3a | 7955 | ZDB-GENE-111207-3 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.