DUSP3

DescriptionDual specificity protein phosphatase 3

Gene and Protein Information

Gene ID1845
Uniprot Accession IDs P51452 D3DX45 Q5U0J1 Q8IYJ9
Ensembl ID ENSP00000226004
Symbol VHR VHR
FamilyBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp468271DUSP3dual specificity phosphatase 39598VGNC:12093OMA, EggNOG
Macaque713686DUSP3dual specificity phosphatase 39544Inparanoid, OMA, EggNOG
Mouse72349Dusp3dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)10090MGI:1919599Inparanoid, OMA, EggNOG
Rat498003Dusp3dual specificity phosphatase 310116RGD:1560049Inparanoid, OMA, EggNOG
Dog480505DUSP3dual specificity phosphatase 39615VGNC:53236Inparanoid, OMA, EggNOG
Horse100064999DUSP3dual specificity phosphatase 39796VGNC:51807Inparanoid, OMA, EggNOG
Cow615432DUSP3dual specificity phosphatase 39913VGNC:28259Inparanoid, OMA, EggNOG
Pig100512983DUSP3dual specificity phosphatase 39823OMA, EggNOG
OpossumDUSP3dual specificity phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:3069]13616Inparanoid, OMA, EggNOG
Anole lizard100555344dusp3dual specificity phosphatase 328377Inparanoid, OMA, EggNOG
Zebrafish100000665dusp3adual specificity phosphatase 3a7955ZDB-GENE-111207-3OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.