224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein quaking |
|---|
Gene and Protein Information
| Gene ID | 9444 |
|---|---|
| Uniprot Accession IDs | Q96PU8 Q2I375 Q5MJQ1 Q969L9 Q96EJ3 Q96KA3 Q96PU6 Q96PU7 Q9P0X6 Q9P0X7 Q9P0X8 Q9P0X9 Q9P0Y0 Q9P0Y1 Hqk |
| Ensembl ID | ENSP00000355094 |
| Symbol | HKQ QK Hqk QK1 QK3 hqkI |
| Sequence | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472181 | QKI | QKI, KH domain containing RNA binding | 9598 | VGNC:14795 | OMA, EggNOG |
| Macaque | 712600 | QKI | QKI, KH domain containing RNA binding | 9544 | OMA, EggNOG | |
| Mouse | 19317 | Qk | quaking | 10090 | MGI:97837 | Inparanoid, OMA, EggNOG |
| Dog | 606754 | QKI | QKI, KH domain containing RNA binding | 9615 | VGNC:45232 | Inparanoid, OMA, EggNOG |
| Horse | 100033866 | QKI | QKI, KH domain containing RNA binding | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 493722 | QKI | QKI, KH domain containing RNA binding | 9913 | VGNC:33597 | Inparanoid, OMA, EggNOG |
| Pig | 492277 | QKI | QKI, KH domain containing RNA binding | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028136 | QKI | QKI, KH domain containing RNA binding | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100078923 | QKI | QKI, KH domain containing RNA binding | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 374204 | QKI | QKI, KH domain containing RNA binding | 9031 | CGNC:8781 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554275 | qki | QKI, KH domain containing RNA binding | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100038174 | qki | QKI, KH domain containing, RNA binding | 8364 | XB-GENE-486525 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100462714 | qkib | QKI, KH domain containing, RNA binding b | 7955 | ZDB-GENE-081028-54 | OMA, EggNOG |
| C. elegans | 188703 | asd-2 | RNA-binding protein asd-2 | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 42596 | how | held out wings | 7227 | FBgn0264491 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / transcription cofactor / Protein quaking
protein / nucleic acid binding / mRNA splicing factor / Protein quaking
protein / nucleic acid binding / transcription cofactor / Protein quaking
protein / nucleic acid binding / mRNA splicing factor / Protein quaking
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Protein quaking
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Protein quaking
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.