🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RXFP4

DescriptionRelaxin-3 receptor 2

Gene and Protein Information

Gene ID339403
Uniprot Accession IDs Q8TDU9 B0M0L4 Q3MJB1 Q8NGZ8 RLN3 receptor 2
Ensembl ID ENSP00000357301
Symbol GPR100 RLN3R2 GPR100 RLN3R2 RXFPR4 GPCR142
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp742539RXFP4relaxin family peptide/INSL5 receptor 49598VGNC:9456OMA, EggNOG
Macaque718025RXFP4relaxin/insulin like family peptide receptor 49544Inparanoid, OMA, EggNOG
Mouse242093Rxfp4relaxin family peptide receptor 410090MGI:2182926Inparanoid, OMA, EggNOG
Horse100063783RXFP4relaxin family peptide/INSL5 receptor 49796VGNC:22638Inparanoid, OMA
OpossumRXFP4relaxin/insulin like family peptide receptor 4 [Source:HGNC Symbol;Acc:HGNC:14666]13616Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Relaxin-3 receptor 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Relaxin-3 receptor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.