🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GID4

DescriptionGlucose-induced degradation protein 4 homolog

Gene and Protein Information

Gene ID79018
Uniprot Accession IDs Q8IVV7 Q8TEB5 Q9BW50
Ensembl ID ENSP00000268719
Symbol C17orf39 VID24 VID2 VID24 C17orf39
FamilyBelongs to the GID4/VID24 family.
Sequence
MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque699842GID4GID complex subunit 4 homolog9544Inparanoid, EggNOG
Mouse66771Gid4GID complex subunit 4, VID24 homolog10090MGI:1914021Inparanoid, EggNOG
Dog479524GID4GID complex subunit 4 homolog9615VGNC:49858Inparanoid, OMA, EggNOG
HorseGID4GID complex subunit 4 homolog [Source:HGNC Symbol;Acc:HGNC:28453]9796OMA, EggNOG
Cow509503GID4GID complex subunit 4 homolog9913Inparanoid, EggNOG
Opossum100029505GID4GID complex subunit 4 homolog13616Inparanoid, EggNOG
Platypus100079577GID4GID complex subunit 4 homolog9258Inparanoid, OMA, EggNOG
Anole lizard100554136gid4GID complex subunit 4 homolog28377Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.