224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | GTPase HRas |
|---|
Gene and Protein Information
| Gene ID | 3265 |
|---|---|
| Uniprot Accession IDs | P01112 B5BUA0 Q14080 Q6FHV9 Q9BR65 Q9UCE2 |
| Ensembl ID | ENSP00000407586 |
| Symbol | HRAS1 CTLO KRAS HAMSV HRAS1 KRAS2 RASH1 RASK2 Ki-Ras p21ras C-H-RAS c-K-ras H-RASIDX c-Ki-ras C-BAS/HAS C-HA-RAS1 |
| Family | Belongs to the small GTPase superfamily. Ras family. |
| Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466302 | HRAS | HRas proto-oncogene, GTPase | 9598 | VGNC:50562 | OMA, EggNOG |
| Macaque | 698830 | HRAS | HRas proto-oncogene, GTPase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15461 | Hras | Harvey rat sarcoma virus oncogene | 10090 | MGI:96224 | Inparanoid, OMA |
| Rat | 293621 | Hras | HRas proto-oncogene, GTPase | 10116 | RGD:2827 | Inparanoid, OMA |
| Horse | 100055481 | HRAS | HRas proto-oncogene, GTPase | 9796 | VGNC:18868 | Inparanoid, OMA |
| Cow | 100298939 | HRAS | HRas proto-oncogene, GTPase | 9913 | VGNC:29951 | Inparanoid, OMA |
| Xenopus | 549757 | hras | Harvey rat sarcoma viral oncogene homolog | 8364 | XB-GENE-479381 | Inparanoid, OMA |
| Zebrafish | 553656 | hrasb | -Ha-ras Harvey rat sarcoma viral oncogene homolog b | 7955 | ZDB-GENE-050522-466 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.