224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone-binding protein RBBP4 |
|---|
Gene and Protein Information
| Gene ID | 5928 |
|---|---|
| Uniprot Accession IDs | Q09028 B2R6G9 B4DRH0 D3DPQ3 P31149 Q53H02 Q96BV9 |
| Ensembl ID | ENSP00000362592 |
| Symbol | RBAP48 NURF55 RBAP48 lin-53 |
| Family | Belongs to the WD repeat RBAP46/RBAP48/MSI1 family. |
| Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 708710 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9544 | Inparanoid, OMA | |
| Mouse | 19646 | Rbbp4 | retinoblastoma binding protein 4, chromatin remodeling factor | 10090 | MGI:1194912 | Inparanoid, OMA |
| Rat | 313048 | Rbbp4 | RB binding protein 4, chromatin remodeling factor | 10116 | RGD:1593768 | Inparanoid, OMA |
| Dog | 478149 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9615 | VGNC:45391 | Inparanoid, OMA |
| Horse | 100070175 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9796 | VGNC:22220 | Inparanoid, OMA |
| Cow | 767940 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9913 | VGNC:33770 | Inparanoid, OMA |
| Opossum | 100025905 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 13616 | Inparanoid, OMA | |
| Chicken | 395658 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9031 | CGNC:2572 | Inparanoid, OMA |
| Anole lizard | 100561534 | rbbp4 | RB binding protein 4, chromatin remodeling factor | 28377 | Inparanoid, OMA | |
| Xenopus | 496866 | rbbp4 | retinoblastoma binding protein 4 | 8364 | XB-GENE-482002 | Inparanoid, OMA |
| Zebrafish | 321726 | rbbp4 | retinoblastoma binding protein 4 | 7955 | ZDB-GENE-030131-445 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.