PLP2

DescriptionProteolipid protein 2

Gene and Protein Information

Gene ID5355
Uniprot Accession IDs Q04941 A6NDT7 Q32MM8
Ensembl ID ENSP00000365505
Symbol A4 A4 A4LSB
Sequence
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque712869PLP2proteolipid protein 29544Inparanoid, OMA
Mouse18824Plp2proteolipid protein 210090MGI:1298382Inparanoid, OMA
Rat302562Plp2proteolipid protein 210116RGD:1587363Inparanoid, OMA
Horse100052104PLP2proteolipid protein 29796VGNC:21589Inparanoid, OMA
Cow399683PLP2proteolipid protein 29913Inparanoid, OMA
Pig100512511PLP2proteolipid protein 29823Inparanoid, OMA
Platypus100076056PLP2proteolipid protein 29258Inparanoid, OMA
Xenopus733483plp2proteolipid protein 28364XB-GENE-1015503Inparanoid, OMA
Zebrafish798079plp2proteolipid protein 27955ZDB-GENE-030710-11Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.