PLSCR3

DescriptionPhospholipid scramblase 3

Gene and Protein Information

Gene ID57048
Uniprot Accession IDs Q9NRY6 A8K252 Q567U0 Q8NBW6 Q96F13 PL scramblase 3
Ensembl ID ENSP00000438547
FamilyBelongs to the phospholipid scramblase family.
Sequence
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp750610PLSCR3phospholipid scramblase 39598VGNC:51726OMA, EggNOG
Macaque721831PLSCR3phospholipid scramblase 39544Inparanoid, OMA
Mouse70310Plscr3phospholipid scramblase 310090MGI:1917560Inparanoid, OMA, EggNOG
Rat360549Plscr3phospholipid scramblase 310116RGD:1307016Inparanoid, OMA, EggNOG
Dog489471PLSCR3phospholipid scramblase 39615Inparanoid, OMA, EggNOG
Horse100072978PLSCR3phospholipid scramblase 39796Inparanoid, OMA, EggNOG
Cow510355PLSCR3phospholipid scramblase 39913Inparanoid, OMA, EggNOG
Pig102163020PLSCR3phospholipid scramblase 39823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.