224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Polyamine-modulated factor 1 |
|---|
Gene and Protein Information
| Gene ID | 100527963 |
|---|---|
| Uniprot Accession IDs | Q6P1K2 A8K0C5 Q5TCJ8 Q5TCJ9 Q5TCK0 Q5TCK1 Q5TCK3 Q69YZ9 Q6PHR4 Q6ZVE6 Q86VJ6 Q8N4T6 Q9UBQ3 PMF-1 |
| Ensembl ID | ENSP00000357259 |
| Symbol | PMF1 PMF-1 |
| Sequence | MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 67037 | Pmf1 | polyamine-modulated factor 1 | 10090 | MGI:1914287 | Inparanoid, OMA |
| Rat | 681050 | Pmf1 | polyamine-modulated factor 1 | 10116 | RGD:1584694 | Inparanoid, OMA |
| Horse | 100146589 | LOC100146589 | polyamine-modulated factor 1 | 9796 | Inparanoid, OMA | |
| Cow | 616311 | PMF1 | polyamine modulated factor 1 | 9913 | Inparanoid, OMA | |
| Pig | 100144449 | PMF1 | polyamine modulated factor 1 | 9823 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.