RALA

DescriptionRas-related protein Ral-A

Gene and Protein Information

Gene ID5898
Uniprot Accession IDs P11233 A4D1W3
Ensembl ID ENSP00000005257
Symbol RAL RAL
FamilyBelongs to the small GTPase superfamily. Ras family.
Sequence
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737424RALARAS like proto-oncogene A9598VGNC:10412OMA, EggNOG
Mouse56044Ralav-ral simian leukemia viral oncogene A (ras related)10090MGI:1927243Inparanoid, OMA, EggNOG
Rat81757RalaRAS like proto-oncogene A10116RGD:619851Inparanoid, OMA
Dog475875RALARAS like proto-oncogene A9615VGNC:45330Inparanoid, OMA, EggNOG
Horse100051360RALARAS like proto-oncogene A9796VGNC:22159Inparanoid, OMA, EggNOG
Cow538477RALARAS like proto-oncogene A9913VGNC:33698Inparanoid, OMA, EggNOG
Pig100622254RALARAS like proto-oncogene A9823OMA, EggNOG
Opossum100011023RALARAS like proto-oncogene A13616Inparanoid, OMA, EggNOG
Anole lizard100555475ralaRAS like proto-oncogene A28377Inparanoid, OMA, EggNOG
Xenopus548669ralav-ral simian leukemia viral oncogene homolog A (ras related)8364XB-GENE-485016Inparanoid, OMA, EggNOG
Zebrafish393993ralaav-ral simian leukemia viral oncogene homolog Aa (ras related)7955ZDB-GENE-040426-1344Inparanoid, OMA, EggNOG
C. elegans175433ral-1RAL (Ras-related GTPase) homolog6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related protein Ral-A
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related protein Ral-A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.