224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cellular retinoic acid-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 1381 |
|---|---|
| Uniprot Accession IDs | P29762 Q6IAY7 Q8WTV5 |
| Ensembl ID | ENSP00000299529 |
| Symbol | RBP5 RBP5 CRABP CRABPI CRABP-I |
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Sequence | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740693 | CRABP1 | cellular retinoic acid binding protein 1 | 9598 | VGNC:2478 | OMA, EggNOG |
| Macaque | 710048 | CRABP1 | cellular retinoic acid binding protein 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12903 | Crabp1 | cellular retinoic acid binding protein I | 10090 | MGI:88490 | Inparanoid, OMA, EggNOG |
| Rat | 25061 | Crabp1 | cellular retinoic acid binding protein 1 | 10116 | RGD:2400 | Inparanoid, OMA, EggNOG |
| Horse | 100050413 | CRABP1 | cellular retinoic acid binding protein 1 | 9796 | VGNC:16846 | Inparanoid, OMA, EggNOG |
| Cow | 282201 | CRABP1 | cellular retinoic acid binding protein 1 | 9913 | VGNC:27685 | Inparanoid, OMA, EggNOG |
| Pig | 100169745 | CRABP1 | cellular retinoic acid binding protein 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012644 | CRABP1 | cellular retinoic acid binding protein 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 374211 | CRABP1 | cellular retinoic acid binding protein 1 | 9031 | CGNC:49086 | Inparanoid, OMA |
| Zebrafish | 415102 | crabp1b | cellular retinoic acid binding protein 1b | 7955 | ZDB-GENE-040624-3 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.