224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Phosphatidylinositol-glycan biosynthesis class X protein |
|---|
Gene and Protein Information
| Gene ID | 54965 |
|---|---|
| Uniprot Accession IDs | Q8TBF5 Q9NWZ2 PIG-X |
| Ensembl ID | ENSP00000296333 |
| Symbol | PIG-X |
| Family | Belongs to the PIGX family. |
| Sequence | MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460964 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9598 | VGNC:2506 | Inparanoid, OMA, EggNOG |
| Macaque | 708566 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9544 | OMA, EggNOG | |
| Mouse | 72084 | Pigx | phosphatidylinositol glycan anchor biosynthesis, class X | 10090 | MGI:1919334 | Inparanoid, OMA, EggNOG |
| Rat | 288041 | Pigx | phosphatidylinositol glycan anchor biosynthesis, class X | 10116 | RGD:1307289 | Inparanoid, OMA, EggNOG |
| Dog | 478602 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9615 | VGNC:44546 | Inparanoid, OMA, EggNOG |
| Horse | PIGX | phosphatidylinositol glycan anchor biosynthesis class X [Source:HGNC Symbol;Acc:HGNC:26046] | 9796 | OMA, EggNOG | ||
| Cow | 100298680 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9913 | VGNC:53598 | Inparanoid, OMA, EggNOG |
| Pig | 100621501 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9823 | OMA, EggNOG | |
| Platypus | 100073572 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9258 | Inparanoid, EggNOG | |
| Chicken | 424859 | PIGX | phosphatidylinositol glycan anchor biosynthesis class X | 9031 | CGNC:4826 | Inparanoid, OMA, EggNOG |
| Zebrafish | 570443 | pigx | phosphatidylinositol glycan anchor biosynthesis, class X | 7955 | ZDB-GENE-070705-212 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.