RAC3

DescriptionRas-related C3 botulinum toxin substrate 3

Gene and Protein Information

Gene ID5881
Uniprot Accession IDs P60763 O14658 Q5U0M8
Ensembl ID ENSP00000304283
FamilyBelongs to the small GTPase superfamily. Rho family.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse170758Rac3Rac family small GTPase 310090MGI:2180784Inparanoid, OMA
Cow619066RAC3Rac family small GTPase 39913Inparanoid, OMA, EggNOG
Opossum100029873RAC3Rac family small GTPase 313616Inparanoid, OMA, EggNOG
Anole lizard100568092rac3Rac family small GTPase 328377Inparanoid, OMA, EggNOG
Zebrafish795167rac3bRac family small GTPase 3b7955ZDB-GENE-080220-21Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related C3 botulinum toxin substrate 3
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related C3 botulinum toxin substrate 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.