224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Pyridoxal kinase |
|---|
Gene and Protein Information
| Gene ID | 8566 |
|---|---|
| Uniprot Accession IDs | O00764 Q7Z2Y0 Q9BS02 |
| Ensembl ID | ENSP00000291565 |
| Symbol | C21orf124 C21orf97 PKH PNK PKH PNK PRED79 C21orf97 HEL-S-1a C21orf124 |
| Family | Belongs to the pyridoxine kinase family. |
| Sequence | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737076 | PDXK | pyridoxal kinase | 9598 | VGNC:14678 | OMA, EggNOG |
| Macaque | 713564 | PDXK | pyridoxal kinase | 9544 | OMA, EggNOG | |
| Mouse | 216134 | Pdxk | pyridoxal (pyridoxine, vitamin B6) kinase | 10090 | MGI:1351869 | Inparanoid, OMA, EggNOG |
| Rat | 83578 | Pdxk | pyridoxal kinase | 10116 | RGD:621324 | OMA, EggNOG |
| Dog | 487788 | PDXK | pyridoxal kinase | 9615 | VGNC:49939 | Inparanoid, OMA, EggNOG |
| Horse | 100050911 | PDXK | pyridoxal kinase | 9796 | VGNC:49516 | Inparanoid, OMA, EggNOG |
| Cow | 514168 | PDXK | pyridoxal kinase | 9913 | VGNC:50243 | Inparanoid, OMA, EggNOG |
| Opossum | PDXK | pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | PDXK | pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819] | 9258 | OMA, EggNOG | ||
| Chicken | 418549 | PDXK | pyridoxal kinase | 9031 | CGNC:12115 | OMA, EggNOG |
| Anole lizard | 100565761 | pdxk | pyridoxal kinase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | pdxk | pyridoxal kina [Source:Xenbase;Acc:XB-GENE-5810533] | 8364 | OMA, EggNOG | ||
| Zebrafish | 564697 | pdxkb | pyridoxal (pyridoxine, vitamin B6) kinase b | 7955 | ZDB-GENE-030616-521 | Inparanoid, OMA |
| C. elegans | 172101 | pdxk-1 | Putative pyridoxal kinase | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 856683 | BUD16 | putative pyridoxal kinase BUD16 | 4932 | S000000755 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.