224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Neuromodulin |
|---|
Gene and Protein Information
| Gene ID | 2596 |
|---|---|
| Uniprot Accession IDs | P17677 A8K0Y4 |
| Ensembl ID | ENSP00000377372 |
| Symbol | B-50 PP46 |
| Family | Belongs to the neuromodulin family. |
| Sequence | MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460599 | GAP43 | growth associated protein 43 | 9598 | VGNC:11399 | Inparanoid, OMA, EggNOG |
| Macaque | 711260 | GAP43 | growth associated protein 43 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14432 | Gap43 | growth associated protein 43 | 10090 | MGI:95639 | Inparanoid, OMA, EggNOG |
| Rat | 29423 | Gap43 | growth associated protein 43 | 10116 | RGD:62071 | Inparanoid, OMA, EggNOG |
| Dog | 478572 | GAP43 | growth associated protein 43 | 9615 | VGNC:41108 | Inparanoid, OMA, EggNOG |
| Cow | 281777 | GAP43 | growth associated protein 43 | 9913 | VGNC:29247 | Inparanoid, OMA, EggNOG |
| Opossum | 100015043 | GAP43 | growth associated protein 43 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 427955 | GAP43 | growth associated protein 43 | 9031 | CGNC:11226 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556380 | gap43 | growth associated protein 43 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | gap43 | growth associated protein 43 [Source:Xenbase;Acc:XB-GENE-5899285] | 8364 | OMA, EggNOG | ||
| Zebrafish | 30608 | gap43 | growth associated protein 43 | 7955 | ZDB-GENE-990415-87 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.