🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NUS1

DescriptionDehydrodolichyl diphosphate synthase complex subunit NUS1

Gene and Protein Information

Gene ID116150
Uniprot Accession IDs Q96E22 B2RWQ4 O00251
Ensembl ID ENSP00000357480
Symbol C6orf68 NGBR NgBR MRD55 CDG1AA C6orf68 TANGO14 MGC:7199
FamilyBelongs to the UPP synthase family.
Sequence
MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462965NUS1NUS1 dehydrodolichyl diphosphate synthase subunit9598OMA, EggNOG
Mouse52014Nus1NUS1 dehydrodolichyl diphosphate synthase subunit10090MGI:1196365Inparanoid, OMA, EggNOG
Rat294400Nus1NUS1 dehydrodolichyl diphosphate synthase subunit10116RGD:1307879Inparanoid, OMA, EggNOG
Dog484102NUS1NUS1, dehydrodolichyl diphosphate synthase subunit9615VGNC:44066Inparanoid, OMA, EggNOG
Horse100067138NUS1NUS1, dehydrodolichyl diphosphate synthase subunit9796VGNC:20979Inparanoid, OMA, EggNOG
Pig100154658NUS1NUS1 dehydrodolichyl diphosphate synthase subunit9823OMA, EggNOG
Opossum100023437NUS1NUS1 dehydrodolichyl diphosphate synthase subunit13616Inparanoid, OMA, EggNOG
Chicken421733NUS1NUS1 dehydrodolichyl diphosphate synthase subunit9031CGNC:11057Inparanoid, OMA, EggNOG
Anole lizard100553689nus1NUS1 dehydrodolichyl diphosphate synthase subunit28377Inparanoid, OMA, EggNOG
Xenopus548844nus1NUS1 dehydrodolichyl diphosphate synthase subunit8364XB-GENE-981164Inparanoid, OMA, EggNOG
Zebrafish436629nus1NUS1, dehydrodolichyl diphosphate synthase subunit7955ZDB-GENE-040718-48Inparanoid, OMA, EggNOG
Fruitfly33298Tango14Transport and Golgi organization 147227FBgn0031312Inparanoid, EggNOG
S.cerevisiae851334NUS1ditrans,polycis-polyprenyl diphosphate synthase4932S000002352Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.