The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
DYNLL1 Description Dynein light chain 1, cytoplasmic
Gene and Protein Information Gene ID 8655 Uniprot Accession IDs P63167 Q15701 Ensembl ID ENSP00000376297 Symbol DLC1 DNCL1 DNCLC1 HDLC1 LC8 PIN DLC1 DLC8 LC8a DNCL1 hdlc1 DNCLC1 Family Belongs to the dynein light chain family. Sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 742676 DYNLL1 dynein light chain LC8-type 1 9598 VGNC:13058 OMA, EggNOG Macaque 702360 DYNLL1 dynein light chain LC8-type 1 9544 Inparanoid, EggNOG Mouse 56455 Dynll1 dynein light chain LC8-type 1 10090 MGI:1861457 Inparanoid, OMA, EggNOG Rat 58945 Dynll1 dynein light chain LC8-type 1 10116 RGD:619866 Inparanoid, OMA Dog 609233 DYNLL1 dynein light chain LC8-type 1 9615 VGNC:40150 Inparanoid, OMA, EggNOG Horse 100053227 DYNLL1 dynein light chain LC8-type 1 9796 VGNC:17372 Inparanoid, OMA Cow 404151 DYNLL1 dynein light chain LC8-type 1 9913 Inparanoid, EggNOG Pig 100157773 DYNLL1 dynein light chain LC8-type 1 9823 OMA, EggNOG Opossum 100018529 DYNLL1 dynein light chain LC8-type 1 13616 Inparanoid, OMA, EggNOG Platypus 100079619 DYNLL1 dynein light chain LC8-type 1 9258 Inparanoid, OMA, EggNOG Anole lizard 100552740 dynll1 dynein light chain LC8-type 1 28377 Inparanoid, OMA Zebrafish 572690 dynll2b dynein, light chain, LC8-type 2b 7955 ZDB-GENE-050320-132 OMA, EggNOG S.cerevisiae 852034 DYN2 dynein light chain 4932 S000002832 OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.