224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | GTP-binding protein Rit1 |
|---|
Gene and Protein Information
| Gene ID | 6016 |
|---|---|
| Uniprot Accession IDs | Q92963 B4DQE8 O00646 O00720 Q5VY89 Q5VY90 |
| Ensembl ID | ENSP00000357305 |
| Symbol | RIBB RIT ROC1 NS8 RIT RIBB ROC1 |
| Family | Belongs to the small GTPase superfamily. Ras family. |
| Sequence | MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457377 | RIT1 | Ras like without CAAX 1 | 9598 | VGNC:10428 | OMA, EggNOG |
| Macaque | 717985 | RIT1 | Ras like without CAAX 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19769 | Rit1 | Ras-like without CAAX 1 | 10090 | MGI:108053 | Inparanoid, OMA, EggNOG |
| Rat | 499652 | Rit1 | Ras-like without CAAX 1 | 10116 | RGD:1559874 | Inparanoid, OMA |
| Dog | 480126 | RIT1 | Ras like without CAAX 1 | 9615 | VGNC:45600 | Inparanoid, OMA |
| Horse | 100063751 | RIT1 | Ras like without CAAX 1 | 9796 | VGNC:22405 | Inparanoid, OMA |
| Cow | 533646 | RIT1 | Ras like without CAAX 1 | 9913 | VGNC:33987 | Inparanoid, OMA |
| Pig | 100155905 | RIT1 | Ras like without CAAX 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100022661 | RIT1 | Ras like without CAAX 1 | 13616 | Inparanoid, OMA | |
| Chicken | 425068 | RIT1 | Ras like without CAAX 1 | 9031 | CGNC:52332 | Inparanoid, OMA |
| Anole lizard | 100566446 | rit1 | Ras like without CAAX 1 | 28377 | Inparanoid, OMA | |
| Zebrafish | 793942 | rit1 | Ras-like without CAAX 1 | 7955 | ZDB-GENE-070912-329 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.