224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Dual specificity tyrosine-phosphorylation-regulated kinase 3 |
|---|
Gene and Protein Information
| Gene ID | 8444 |
|---|---|
| Uniprot Accession IDs | O43781 D3DT79 Q7Z752 Q9HBY6 Q9HBY7 |
| Ensembl ID | ENSP00000356076 |
| Symbol | RED REDK DYRK5 hYAK3-2 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily. |
| Sequence | MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 695163 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9544 | Inparanoid, OMA | |
| Mouse | 226419 | Dyrk3 | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 | 10090 | MGI:1330300 | Inparanoid, OMA |
| Rat | 304775 | Dyrk3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 10116 | RGD:1310924 | Inparanoid, OMA |
| Dog | 480010 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9615 | VGNC:40158 | Inparanoid, OMA |
| Horse | 100055466 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9796 | VGNC:17378 | Inparanoid, OMA |
| Cow | 505149 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9913 | VGNC:28281 | Inparanoid, OMA |
| Opossum | 100014844 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 13616 | Inparanoid, OMA | |
| Chicken | 419846 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9031 | CGNC:565 | Inparanoid, OMA |
| Anole lizard | 100565585 | dyrk3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 28377 | Inparanoid, OMA | |
| Xenopus | 493520 | dyrk3 | dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 | 8364 | XB-GENE-1008699 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.