🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RASD2

DescriptionGTP-binding protein Rhes

Gene and Protein Information

Gene ID23551
Uniprot Accession IDs Q96D21 O95520 Q5THY8
Ensembl ID ENSP00000216127
Symbol TEM2 Rhes TEM2
FamilyBelongs to the small GTPase superfamily. RasD family.
Sequence
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470196RASD2RASD family member 29598VGNC:6018OMA, EggNOG
Mouse75141Rasd2RASD family, member 210090MGI:1922391Inparanoid, OMA, EggNOG
Rat171099Rasd2RASD family, member 210116RGD:628594Inparanoid, OMA, EggNOG
Dog481284RASD2RASD family member 29615VGNC:45365Inparanoid, OMA, EggNOG
Horse100054386RASD2RASD family member 29796VGNC:22194Inparanoid, OMA, EggNOG
Cow527921RASD2RASD family member 29913VGNC:33741Inparanoid, OMA, EggNOG
Opossum100016530RASD2RASD family member 213616Inparanoid, OMA, EggNOG
PlatypusRASD2RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:18229]9258OMA, EggNOG
Chicken418057RASD2RASD family member 29031CGNC:9520Inparanoid, OMA
Anole lizard100559661rasd2RASD family member 228377Inparanoid, OMA
Xenopus548760rasd2RASD family member 28364XB-GENE-494969Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.