224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | E3 ubiquitin-protein ligase RING1 |
|---|
Gene and Protein Information
| Gene ID | 6015 |
|---|---|
| Uniprot Accession IDs | Q06587 A8JZZ0 Q5JP96 Q5SQW2 Q86V19 |
| Ensembl ID | ENSP00000363787 |
| Symbol | RNF1 RNF1 RING1A |
| Sequence | MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462604 | RING1 | ring finger protein 1 | 9598 | VGNC:11205 | Inparanoid, OMA |
| Macaque | 718137 | RING1 | ring finger protein 1 | 9544 | Inparanoid, OMA | |
| Mouse | 19763 | Ring1 | ring finger protein 1 | 10090 | MGI:1101770 | Inparanoid, OMA |
| Rat | 309626 | Ring1 | ring finger protein 1 | 10116 | RGD:3576 | Inparanoid, OMA |
| Dog | 607905 | RING1 | ring finger protein 1 | 9615 | VGNC:45589 | Inparanoid, OMA |
| Horse | 100061452 | RING1 | ring finger protein 1 | 9796 | VGNC:22394 | Inparanoid, OMA |
| Cow | 100125778 | RING1 | ring finger protein 1 | 9913 | VGNC:33977 | Inparanoid, OMA |
| Pig | 100153162 | RING1 | ring finger protein 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100618862 | RING1 | ring finger protein 1 | 13616 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.