224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | MKI67 FHA domain-interacting nucleolar phosphoprotein |
|---|
Gene and Protein Information
| Gene ID | 84365 |
|---|---|
| Uniprot Accession IDs | Q9BYG3 A8K788 Q8TB66 Q96ED4 |
| Ensembl ID | ENSP00000285814 |
| Symbol | MKI67IP NOPP34 Nopp34 MKI67IP |
| Sequence | MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459585 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9598 | VGNC:2712 | OMA, EggNOG |
| Macaque | 697198 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9544 | OMA, EggNOG | |
| Mouse | 67949 | Nifk | nucleolar protein interacting with the FHA domain of MKI67 | 10090 | MGI:1915199 | Inparanoid, OMA, EggNOG |
| Rat | 246042 | Nifk | nucleolar protein interacting with the FHA domain of MKI67 | 10116 | RGD:708462 | Inparanoid, OMA, EggNOG |
| Dog | 100856252 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9615 | VGNC:43809 | OMA, EggNOG |
| Horse | 100055172 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9796 | VGNC:51485 | OMA, EggNOG |
| Cow | 509598 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9913 | VGNC:32076 | Inparanoid, OMA, EggNOG |
| Pig | 100124386 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9823 | OMA, EggNOG | |
| Opossum | 100011091 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 13616 | OMA, EggNOG | |
| Chicken | 424239 | NIFK | nucleolar protein interacting with the FHA domain of MKI67 | 9031 | CGNC:8852 | OMA, EggNOG |
| Anole lizard | 100564113 | nifk | nucleolar protein interacting with the FHA domain of MKI67 | 28377 | OMA, EggNOG | |
| Zebrafish | 317644 | nifk | nucleolar protein interacting with the FHA domain of MKI67 | 7955 | ZDB-GENE-021231-4 | Inparanoid, OMA, EggNOG |
| Fruitfly | 42662 | CG6937 | CG6937 gene product from transcript CG6937-RA | 7227 | FBgn0038989 | Inparanoid, EggNOG |
| S.cerevisiae | 855613 | NOP15 | rRNA-binding ribosome biosynthesis protein NOP15 | 4932 | S000005054 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.