224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Galectin-3 |
|---|
Gene and Protein Information
| Gene ID | 3958 |
|---|---|
| Uniprot Accession IDs | P17931 B2RC38 Q16005 Q6IBA7 Q96J47 Gal-3 |
| Ensembl ID | ENSP00000254301 |
| Symbol | MAC2 L31 GAL3 MAC2 CBP35 GALBP GALIG LGALS2 |
| Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744038 | LGALS3 | galectin 3 | 9598 | VGNC:48879 | OMA, EggNOG |
| Macaque | 697290 | LGALS3 | galectin 3 | 9544 | Inparanoid, OMA | |
| Mouse | 16854 | Lgals3 | lectin, galactose binding, soluble 3 | 10090 | MGI:96778 | Inparanoid, OMA, EggNOG |
| Rat | 83781 | Lgals3 | galectin 3 | 10116 | RGD:69356 | Inparanoid, OMA, EggNOG |
| Dog | 404021 | LGALS3 | galectin 3 | 9615 | VGNC:42648 | Inparanoid, OMA, EggNOG |
| Horse | 100050367 | LGALS3 | galectin 3 | 9796 | VGNC:19641 | Inparanoid, OMA, EggNOG |
| Cow | 786492 | LGALS3 | galectin 3 | 9913 | VGNC:30852 | Inparanoid, OMA, EggNOG |
| Pig | 100038033 | LGALS3 | galectin 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024258 | LGALS3 | galectin 3 | 13616 | Inparanoid, EggNOG | |
| Platypus | LGALS3 | galectin 3 [Source:HGNC Symbol;Acc:HGNC:6563] | 9258 | OMA, EggNOG | ||
| Chicken | 373917 | LGALS3 | galectin 3 | 9031 | CGNC:9239 | Inparanoid, OMA |
| Anole lizard | 100562243 | lgals3 | galectin 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394583 | lgals3 | lectin, galactoside-binding, soluble, 3 | 8364 | XB-GENE-983743 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.