🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

LAG3

DescriptionLymphocyte activation gene 3 protein

Gene and Protein Information

Gene ID3902
Uniprot Accession IDs P18627 A8K7T9 Q7Z643 LAG-3
Ensembl ID ENSP00000203629
Symbol FDC CD223
Sequence
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451794LAG3lymphocyte activating 39598VGNC:8443OMA, EggNOG
Mouse16768Lag3lymphocyte-activation gene 310090MGI:106588Inparanoid, OMA, EggNOG
Rat297596Lag3lymphocyte activating 310116RGD:1302990Inparanoid, OMA, EggNOG
Dog486720LAG3lymphocyte activating 39615VGNC:42562Inparanoid, OMA, EggNOG
Horse100059998LAG3lymphocyte activating 39796VGNC:19561Inparanoid, OMA, EggNOG
Cow515155LAG3lymphocyte activating 39913VGNC:30767Inparanoid, OMA, EggNOG
Opossum103101818LAG3lymphocyte activating 313616Inparanoid, OMA, EggNOG
Anole lizardLAG3lymphocyte activating 3 [Source:HGNC Symbol;Acc:HGNC:6476]28377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    type I cytokine receptor    /    Lymphocyte activation gene 3 protein
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type I cytokine receptor    /    Lymphocyte activation gene 3 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.