224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Kallikrein-2 |
|---|
Gene and Protein Information
| Gene ID | 3817 |
|---|---|
| Uniprot Accession IDs | P20151 B4DU93 B4DUB0 F5H8L3 Q15946 Q9UJZ9 |
| Ensembl ID | ENSP00000313581 |
| Symbol | hK2 hGK-1 KLK2A2 |
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
| Sequence | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748637 | LOC748637 | kallikrein-2 | 9598 | OMA, EggNOG | |
| Mouse | 16612 | Klk1 | kallikrein 1 | 10090 | MGI:102850 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.